PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G133000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 176aa    MW: 19443.7 Da    PI: 8.719
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G133000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.76.8e-153898363
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        elkr rr+++NRe+A+rsRqRK++ ++ L   v++L +  ++L   l++ ++++a+ ++++
  Sevir.6G133000.1.p 38 ELKRKRRMESNRESAKRSRQRKQQHLDDLNSQVDQLRTTKQQLLTALNNTTQNYAAAEAQN 98
                        79***************************************************99888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-1436100IPR004827Basic-leucine zipper domain
PfamPF001705.0E-123894IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.48438101IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.02E-113992No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-1140113No hitNo description
CDDcd147025.90E-164192No hitNo description
PROSITE patternPS0003604358IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MTLLGGTFSS GSGTSSGSSH GTRSFGSEGD MELQARMELK RKRRMESNRE SAKRSRQRKQ  60
QHLDDLNSQV DQLRTTKQQL LTALNNTTQN YAAAEAQNSV LRTQMIELES RLSALRDIIC  120
YMNANLQVSN SATINANPST IMGVTANYDA FDASAWNSGM PMVQQPIDHL LYQCF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15257KRSRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973271.11e-128PREDICTED: ocs element-binding factor 1-like isoform X1
TrEMBLK3YJV41e-128K3YJV4_SETIT; Uncharacterized protein
STRINGSi014523m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-24basic leucine-zipper 44